DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Chrdl1

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_006529064.1 Gene:Chrdl1 / 83453 MGIID:1933172 Length:450 Species:Mus musculus


Alignment Length:411 Identity:81/411 - (19%)
Similarity:116/411 - (28%) Gaps:183/411 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 CSFRGMSYESGSEWNDPEDPCKTYKCVATVVTETIQKCYSQCDNNQLQPPRPGECCPTCQGCKIN 187
            |.|:...|..|.:|:...:|.....||..:                               |..|
Mouse    32 CVFQDKKYRVGEKWHPYLEPYGLVYCVNCI-------------------------------CSEN 65

  Fly   188 GQTVAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRCPQNHSFLPV 252
            |..:                         ||:..||.|.|.....|  |..||||||:: |..||
Mouse    66 GNVL-------------------------CSRVRCPSLHCLSPVHI--PHLCCPRCPED-SLPPV 102

  Fly   253 PGK-----CLFNKSVYPEKTQFM---------PDRCTNCTCLNGTSVCQRPTCPILECAPEFQEP 303
            ..|     |.:|.:.|.....|:         |::|:.|:|..|...|...|||.|.||.....|
Mouse   103 NNKVTSKSCEYNGTTYQHGELFIAEGLFQNRQPNQCSQCSCSEGNVYCGLKTCPKLTCAFPVSVP 167

  Fly   304 DGCCPRC-------------------AVAEVRSE------------------------------- 318
            |.||..|                   |..|.|..                               
Mouse   168 DSCCRVCRGDAELSWEHADGDIFRQPANREARHSYLRSPYDPPPNRQAGGLPRFPGSRSHRGAVI 232

  Fly   319 -------------------------CSLDGIVYQNNETW-------DMGPCRSCRCNGGTIRCAQ 351
                                     |..:|..|.:.|:|       .:..|..|.||.....|.:
Mouse   233 DSQQASGTIVQIVINNKHKHGQGKVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKK 297

  Fly   352 MRCP-AVKCRANEELKQPPGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMG 415
            :.|| ...|:..:::   .|:||:.|.|         :|..:.||.|            .|.|..
Mouse   298 IHCPNRYPCKYPQKI---DGKCCKVCPE---------EPPSQNFDSK------------GSFCGE 338

  Fly   416 KTFHIR---LTNEGRGTRRAS 433
            :|..:.   ...:|..||:.:
Mouse   339 ETMPVYESVFMEDGETTRKVA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 14/58 (24%)
VWC 256..310 CDD:278520 20/62 (32%)
VWC 319..376 CDD:214564 16/64 (25%)
VWD 371..536 CDD:214566 14/66 (21%)
C8 580..646 CDD:285899
Chrdl1XP_006529064.1 VWC 32..94 CDD:327433 22/119 (18%)
VWC 111..174 CDD:327433 20/62 (32%)
VWC 258..320 CDD:327433 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.