DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and vwc2

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001108100.1 Gene:vwc2 / 798521 ZFINID:ZDB-GENE-090313-315 Length:309 Species:Danio rerio


Alignment Length:228 Identity:62/228 - (27%)
Similarity:90/228 - (39%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LQGRTVDA----------------GAGDSLSGVRQ---------SCSNE-------GEEVQLKNQ 78
            |||:|::|                .|..||..:.:         .|.:|       ||    |..
Zfish    94 LQGKTLEAWSEQESLKQTEGAPTEEANVSLDAIDEYAYPDYRGKGCMDETGFVFAIGE----KFT 154

  Fly    79 PQIFTCFKCEC-QNGFVNCRDTCPPVND-CYILDKSNGTCCRRCKG----CSFRGMSYESGSEWN 137
            |...|| .|.| ..|.:..:..||.::. |..:|.|.  ||.:||.    |.|||..|.|..|:.
Zfish   155 PGPSTC-PCLCTDEGPLCAQPECPKLHPRCLRVDTSQ--CCPQCKEKKNYCEFRGKIYSSLEEFK 216

  Fly   138 DPEDPCKTYKCVAT-VVTETIQKC-YSQCDNNQLQPPRPGECCPTCQ---GCKINGQTVAEGHEV 197
              ..||:..:|..: .|..::..| .::|.:.:.:   |.:|||.|:   .|..:...:..|.||
Zfish   217 --VSPCEKCRCEPSGEVLCSVSACPQTECVDPEYE---PDQCCPVCKSGPNCYADTSVIPAGREV 276

  Fly   198 DASIDDRCLVCQC---RGT-----QLTCSKKTC 222
            ..   |.|.:|.|   .||     |.||||..|
Zfish   277 KI---DECTICYCTYEEGTWRIERQATCSKNEC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 16/47 (34%)
VWC 256..310 CDD:278520
VWC 319..376 CDD:214564
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
vwc2NP_001108100.1 VWC 202..257 CDD:302663 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.