DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and zgc:113531

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001013504.1 Gene:zgc:113531 / 541359 ZFINID:ZDB-GENE-050320-52 Length:217 Species:Danio rerio


Alignment Length:201 Identity:51/201 - (25%)
Similarity:77/201 - (38%) Gaps:40/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 CKINGQT--VAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRCPQN 246
            |:.||..  |.|.:.:|:   |.|..|:|......|::..|..||.........|.:|||||.:.
Zfish    37 CEANGSVYYVGEWYFLDS---DPCTQCECTADGSACARTECTSLPTACIHVSHYPTDCCPRCEKI 98

  Fly   247 HSFLPVPGKCLFNKSVYPEKTQFMPDRCTNCTCL-NGTSVCQRPTCPILECAPEFQEPDGCCPRC 310
                    .|.:...||.....|.|..|..|||. :|.:.||...|....|.....:...|||:|
Zfish    99 --------GCEYGGEVYELGQHFQPSACEQCTCYSDGIAHCQVADCAPPPCVDPVYQKGECCPQC 155

  Fly   311 A------VAEVRSECSLDGIVYQNNETWDMGPCRSCRCN---------GGTI-RCAQMRCPAVKC 359
            .      |...|::     ::......| :..|..|||:         |..: .|:::|    .|
Zfish   156 KDGPNCYVNASRTQ-----VIPGGESVW-VDSCTKCRCHDIQDAGYWEGNRLAMCSRIR----NC 210

  Fly   360 RANEEL 365
            :.:|.|
Zfish   211 QPDEGL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 18/60 (30%)
VWC 256..310 CDD:278520 17/54 (31%)
VWC 319..376 CDD:214564 11/57 (19%)
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
zgc:113531NP_001013504.1 VWC 100..155 CDD:214564 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.