Sequence 1: | NP_524809.2 | Gene: | cv-2 / 45280 | FlyBaseID: | FBgn0000395 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013504.1 | Gene: | zgc:113531 / 541359 | ZFINID: | ZDB-GENE-050320-52 | Length: | 217 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 77/201 - (38%) | Gaps: | 40/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 CKINGQT--VAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRCPQN 246
Fly 247 HSFLPVPGKCLFNKSVYPEKTQFMPDRCTNCTCL-NGTSVCQRPTCPILECAPEFQEPDGCCPRC 310
Fly 311 A------VAEVRSECSLDGIVYQNNETWDMGPCRSCRCN---------GGTI-RCAQMRCPAVKC 359
Fly 360 RANEEL 365 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cv-2 | NP_524809.2 | VWC | 184..243 | CDD:214564 | 18/60 (30%) |
VWC | 256..310 | CDD:278520 | 17/54 (31%) | ||
VWC | 319..376 | CDD:214564 | 11/57 (19%) | ||
VWD | 371..536 | CDD:214566 | |||
C8 | 580..646 | CDD:285899 | |||
zgc:113531 | NP_001013504.1 | VWC | 100..155 | CDD:214564 | 17/54 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.870 |