DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Vwc2l

DIOPT Version :10

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001400873.1 Gene:Vwc2l / 501160 RGDID:1565501 Length:222 Species:Rattus norvegicus


Alignment Length:132 Identity:42/132 - (31%)
Similarity:57/132 - (43%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 VYPEKTQFMPDRCTNCTC---LNGTSVCQRPTCPILECAPEFQEPDGCCPRCAVAEVRSECSLDG 323
            ||....:|.|.. :||.|   |:| .||.:|.||.:.......|.:||||.|  .||::.|...|
  Rat    60 VYKLGERFFPGH-SNCPCVCALDG-PVCDQPECPKIHPKCTKVEHNGCCPEC--KEVKNFCEYHG 120

  Fly   324 IVYQNNETWDMGPCRSCRCN-GGTIRCAQMRCPAVKCRANEELKQPPGECCQRCVE----TAGTC 383
            ..|:..|.:...||..|||. ...:.|....|...:| .|...:  |.:||..|..    .|||.
  Rat   121 KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPEC-VNPIYE--PEQCCPVCKNGPNCFAGTT 182

  Fly   384 TV 385
            .:
  Rat   183 II 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564
VWC 256..310 CDD:278520 19/50 (38%)
VWC 319..376 CDD:214564 16/57 (28%)
VWD 371..536 CDD:214566 6/19 (32%)
C8 580..646 CDD:462584
Vwc2lNP_001400873.1 VWC 116..171 CDD:450195 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.