DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and tnc

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001247300.1 Gene:tnc / 42990 FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster


Alignment Length:275 Identity:68/275 - (24%)
Similarity:94/275 - (34%) Gaps:81/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QGCKINGQTVAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQI-------KRPDEC 239
            :||..|.....||..:  ..::.||.|.|....|.|..:.     ||.:|.|       ||.|:|
  Fly    45 EGCYYNYAHYQEGDRI--MTNEPCLNCTCHNRMLMCYLRV-----CPFTKPIGHDCIVEKREDQC 102

  Fly   240 CP--RCPQ------NHSFLPVPGK---------CLFNKSVYPEKTQF--MPDR-CTNCTCLNGTS 284
            ||  .||:      .||  |.||.         |...:..|||..|.  .|:: |..|.|:|..:
  Fly   103 CPIITCPEVPVDVPYHS--PEPGTELSIPEKFGCSIEEKFYPEGAQVPSNPNKPCELCYCINNQT 165

  Fly   285 VC--QRPTCPILECAPEFQEPDGCCP---RC---------------AVAEVR------------- 316
            .|  |..|..:..|.|.:.: ..|||   .|               ....||             
  Fly   166 KCVMQECTLHVDGCLPIYNK-GSCCPVRYSCDHENELDFMDQSTTTTTTTVRPTTGFILASTMTP 229

  Fly   317 ---SECSLDGIVYQNNETW-DMGPCRSCRCNGGTIRCAQMRCPAVKCRAN----EELKQPPGECC 373
               ::|..||.::.:..:. ....|..|.|..|.|.||...|......||    ..:....||||
  Fly   230 PTTTDCIHDGEIFADGASLKGKNACEHCYCMRGDIVCAVQECEVPMMAANGKSCRAMPAAEGECC 294

  Fly   374 QR---CVETAGTCTV 385
            ..   |.:.:.|..:
  Fly   295 PSNYVCEDDSSTTEI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 20/67 (30%)
VWC 256..310 CDD:278520 18/61 (30%)
VWC 319..376 CDD:214564 17/64 (27%)
VWD 371..536 CDD:214566 5/18 (28%)
C8 580..646 CDD:285899
tncNP_001247300.1 VWC 235..296 CDD:214564 17/60 (28%)
PHA02664 <433..595 CDD:177447
Ehrlichia_rpt 529..1065 CDD:118064
DUF863 <1684..>1788 CDD:283539
VWC 2762..>2805 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46698
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.