DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and VWC2

DIOPT Version :10

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_940972.2 Gene:VWC2 / 375567 HGNCID:30200 Length:325 Species:Homo sapiens


Alignment Length:167 Identity:47/167 - (28%)
Similarity:65/167 - (38%) Gaps:28/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PRCPQNHSFLPVPGKCLFNKS--VYP--EKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQ 301
            |..|:.:.:....||...::|  ||.  ||....|..|. |.|.....:|.:|.||.|.......
Human   139 PEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACP-CLCTEEGPLCAQPECPRLHPRCIHV 202

  Fly   302 EPDGCCPRCAVAEVRSECSLDGIVYQNNETWDMGPCRSCRCN-GGTIRCAQMRCPAVKCRANEEL 365
            :...|||:|  .|.::.|...|..||..|.:.:.||..|||. .|.:.|....||..:|   .:.
Human   203 DTSQCCPQC--KERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTEC---VDP 262

  Fly   366 KQPPGECCQRC-------VETA----------GTCTV 385
            ...|.:||..|       .|||          ..||:
Human   263 VYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 1/1 (100%)
VWC 256..310 CDD:278520 17/57 (30%)
VWC 319..376 CDD:214564 18/57 (32%)
VWD 371..536 CDD:214566 8/32 (25%)
C8 580..646 CDD:462584
VWC2NP_940972.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..121
Mediates cell adhesion. /evidence=ECO:0000250 114..116
VWC 218..273 CDD:450195 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.