DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Vwc2

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_796007.1 Gene:Vwc2 / 319922 MGIID:2442987 Length:324 Species:Mus musculus


Alignment Length:167 Identity:47/167 - (28%)
Similarity:66/167 - (39%) Gaps:28/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PRCPQNHSFLPVPGKCLFNKS--VYP--EKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQ 301
            |..|:.:::....||...::|  ||.  ||....|..|. |.|.....:|.:|.||.|.......
Mouse   138 PELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACP-CLCTEEGPLCAQPECPRLHPRCIHV 201

  Fly   302 EPDGCCPRCAVAEVRSECSLDGIVYQNNETWDMGPCRSCRCN-GGTIRCAQMRCPAVKCRANEEL 365
            :...|||:|  .|.::.|...|..||..|.:.:.||..|||. .|.:.|....||..:|   .:.
Mouse   202 DNSQCCPQC--KEKKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTEC---VDP 261

  Fly   366 KQPPGECCQRC-------VETA----------GTCTV 385
            ...|.:||..|       .|||          ..||:
Mouse   262 VYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 1/1 (100%)
VWC 256..310 CDD:278520 17/57 (30%)
VWC 319..376 CDD:214564 18/57 (32%)
VWD 371..536 CDD:214566 8/32 (25%)
C8 580..646 CDD:285899
Vwc2NP_796007.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..126
Mediates cell adhesion 114..116
VWC 217..272 CDD:327433 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.