DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Muc14A

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster


Alignment Length:308 Identity:56/308 - (18%)
Similarity:94/308 - (30%) Gaps:102/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SLSGVRQSCSNEGEEVQLKNQPQIFTCFKCECQNGFVNCRDTCPPVNDCYILDKSNGTCCRRCK- 121
            :|:|.:.:..:|..  .||....:.|...|||         ||       :|::.|.:|...|. 
  Fly   726 NLAGKKTTMPSELS--SLKKIEPVKTHDVCEC---------TC-------LLEQGNDSCTCNCMT 772

  Fly   122 --------------------------------GCSFRGM-----SYESGSEWNDPEDPCKTYKCV 149
                                            ...|..:     :|:.....||.|...|:...:
  Fly   773 DFISTSIQISSTGPDQISQNKMGNQSQSVPLLNTEFSDLMKISTTYKMHQTQNDIEKLSKSPPVL 837

  Fly   150 ATV--------VTETIQK---------CYSQCDNNQLQPPRPGECCPTCQGCKINGQTVAEGHEV 197
            :|.        .|.|::|         ..|...|...:......|..|||        :..|.  
  Fly   838 STTSSGLPKWPTTRTLEKKKQQSKSLPSLSTISNFHFEKSNFHGCDCTCQ--------LELGR-- 892

  Fly   198 DASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRCPQNHSFLPVPGKCLFNKSV 262
                 |.| :|:|...:.|....|..... |:..::....:..|     ||......:.|.:|.:
  Fly   893 -----DSC-ICECNFKESTSDVSTSRSNQ-PLPTKLHSVKDNAP-----HSLTNANPESLTSKDL 945

  Fly   263 YPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGCCPRC 310
            ..:......::.|..:.|:..:||: .|| :||     |..|.|...|
  Fly   946 TTKGNGVTDNKITTLSKLSSDNVCE-CTC-LLE-----QGNDSCTCNC 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 9/58 (16%)
VWC 256..310 CDD:278520 13/53 (25%)
VWC 319..376 CDD:214564
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.