Sequence 1: | NP_524809.2 | Gene: | cv-2 / 45280 | FlyBaseID: | FBgn0000395 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101007.1 | Gene: | Chrdl2 / 308854 | RGDID: | 1306179 | Length: | 429 | Species: | Rattus norvegicus |
Alignment Length: | 295 | Identity: | 69/295 - (23%) |
---|---|---|---|
Similarity: | 97/295 - (32%) | Gaps: | 96/295 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 RPGECCPTCQGCKINGQTVAEGHEVDASIDDRCLVCQC-RGTQLTCSKKTCPVLPCPMSKQIKRP 236
Fly 237 DECCPRC--PQNHSFLPVPGK-CLFNKSVYPEKTQF---------MPDRCTNCTCLNGTSVCQRP 289
Fly 290 TCPILECAPEFQEPDGCCPRCAVAEVRSE------------------------------------ 318
Fly 319 --------------------------------CSLDGIVYQNNETW-----DMG--PCRSCRCNG 344
Fly 345 GTIRCAQMRCPA-VKCRANEELKQPPGECCQRCVE 378 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cv-2 | NP_524809.2 | VWC | 184..243 | CDD:214564 | 17/59 (29%) |
VWC | 256..310 | CDD:278520 | 17/62 (27%) | ||
VWC | 319..376 | CDD:214564 | 19/64 (30%) | ||
VWD | 371..536 | CDD:214566 | 4/8 (50%) | ||
C8 | 580..646 | CDD:285899 | |||
Chrdl2 | NP_001101007.1 | VWC | 33..95 | CDD:302663 | 18/65 (28%) |
VWC | 111..174 | CDD:302663 | 17/62 (27%) | ||
VWC | 251..313 | CDD:278520 | 19/64 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |