DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Chrdl2

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001101007.1 Gene:Chrdl2 / 308854 RGDID:1306179 Length:429 Species:Rattus norvegicus


Alignment Length:295 Identity:69/295 - (23%)
Similarity:97/295 - (32%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RPGECCPTCQGCKINGQTVAEGHEVDASIDDRCLVCQC-RGTQLTCSKKTCPVLPCPMSKQIKRP 236
            |||:.|...:.....||:.....|...:|  .|:.|.| ....:.|.:..||.|.|  |:.:..|
  Rat    28 RPGKVCLFGEKIYTPGQSWHPYLEPQGTI--YCVRCTCSENGHVNCYRLRCPPLHC--SQPVMEP 88

  Fly   237 DECCPRC--PQNHSFLPVPGK-CLFNKSVYPEKTQF---------MPDRCTNCTCLNGTSVCQRP 289
            .:|||||  |:..|.|.||.| |..|::.|.....|         :.::|..|:|:.|.:.|...
  Rat    89 QQCCPRCVDPRVPSGLRVPLKSCQLNETTYQHGEIFSAQELFPARLSNQCVLCSCIEGHTYCGLM 153

  Fly   290 TCPILECAPEFQEPDGCCPRCAVAEVRSE------------------------------------ 318
            |||...|......||.||..|......|.                                    
  Rat   154 TCPEPSCPSTLPLPDSCCQTCKDRTTESSTEENLTQLQHGERHSQDPCSDDGKRRGPSTPAPTSL 218

  Fly   319 --------------------------------CSLDGIVYQNNETW-----DMG--PCRSCRCNG 344
                                            |:.:|..|.:.|.|     ..|  ||..|.|..
  Rat   219 SSPLGFIPRHFQAIGMGGTTIKIILKEKHKKACTHNGKTYSHGEVWHPTVLSFGPMPCILCTCMD 283

  Fly   345 GTIRCAQMRCPA-VKCRANEELKQPPGECCQRCVE 378
            |...|.::.||. ..|   .:.|:..|:||:.|.|
  Rat   284 GYQDCHRVTCPTQYPC---SQPKKVAGKCCKTCPE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 17/59 (29%)
VWC 256..310 CDD:278520 17/62 (27%)
VWC 319..376 CDD:214564 19/64 (30%)
VWD 371..536 CDD:214566 4/8 (50%)
C8 580..646 CDD:285899
Chrdl2NP_001101007.1 VWC 33..95 CDD:302663 18/65 (28%)
VWC 111..174 CDD:302663 17/62 (27%)
VWC 251..313 CDD:278520 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.