Sequence 1: | NP_524809.2 | Gene: | cv-2 / 45280 | FlyBaseID: | FBgn0000395 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317785.1 | Gene: | cutl-23 / 189610 | WormBaseID: | WBGene00021343 | Length: | 773 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 42/201 - (20%) |
---|---|---|---|
Similarity: | 65/201 - (32%) | Gaps: | 74/201 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 369 PGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMGKTFHIRLTNEGRGTRRAS 433
Fly 434 WAKTVTLSLRNLK-VNLGQRMRVKVNGTRVTLPYFVVAGGQNV--TIERLANGGAVM-----LRS 490
Fly 491 EMGLT------------LEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDE 543
Fly 544 VWHFAN 549 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cv-2 | NP_524809.2 | VWC | 184..243 | CDD:214564 | |
VWC | 256..310 | CDD:278520 | |||
VWC | 319..376 | CDD:214564 | 2/6 (33%) | ||
VWD | 371..536 | CDD:214566 | 35/184 (19%) | ||
C8 | 580..646 | CDD:285899 | |||
cutl-23 | NP_001317785.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |