DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and R11G1.1

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001361923.1 Gene:R11G1.1 / 187815 WormBaseID:WBGene00020010 Length:1745 Species:Caenorhabditis elegans


Alignment Length:245 Identity:52/245 - (21%)
Similarity:72/245 - (29%) Gaps:111/245 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CQNGFVNC-RDTCPPVN-------DCYILDKSNGTCCRRCKGCSFRGMSYESGSEWNDPEDPCKT 145
            |..|..:| ...|.|::       ||  :|.|:..|......|   |..|            |..
 Worm    33 CMLGDYDCGLGQCVPISQFRDGKPDC--MDGSDEWCFIGQVSC---GPVY------------CAD 80

  Fly   146 YK----CVATVVTETIQKCYSQCDNNQLQPPRPGECCPTCQ----------GCKINGQTVAEGHE 196
            ||    |:.          |.:||.:..|.|    .|.|.:          .||..|:       
 Worm    81 YKDALPCIV----------YPKCDGSSKQLP----WCSTSKEKLCADETSFPCKGYGE------- 124

  Fly   197 VDASIDDRCLVCQCRGTQLTCSKKTCP---------VLPCPMSKQIKRPDECCPRCPQNHSFL-- 250
                    |::.:    .|...||.|.         |:|.          |...||.:|.|.|  
 Worm   125 --------CVLWE----WLLDGKKDCNDGSDEDENYVMPL----------EHAYRCARNQSGLYL 167

  Fly   251 --PVPGKCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAP 298
              |||.....:.|:|.|                |.|:|.:|:...|...|
 Worm   168 PKPVPPPPEDHPSLYVE----------------GCSMCSKPSTVTLPSNP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 11/67 (16%)
VWC 256..310 CDD:278520 9/43 (21%)
VWC 319..376 CDD:214564
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
R11G1.1NP_001361923.1 LDLa 32..64 CDD:197566 9/32 (28%)
LDLa 113..145 CDD:238060 8/50 (16%)
PHA03247 <268..594 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.