DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and irg-5

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001366887.1 Gene:irg-5 / 185307 WormBaseID:WBGene00009429 Length:343 Species:Caenorhabditis elegans


Alignment Length:205 Identity:41/205 - (20%)
Similarity:59/205 - (28%) Gaps:76/205 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 TIRCAQMRCPAVKCRANEELKQ--PPGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYL 408
            |...||..||......|..:..  |||......|....|||              |.|.      
 Worm    14 TFVAAQFSCPLNTISKNNGMSGSIPPGAASMVQVPAGSTCT--------------FKFD------ 58

  Fly   409 LASDCMGKTFHIRLTNEGRGTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVV---- 469
                 :.|.|.:::..    |.....:|..::...:..:......:::. ..|.||||.||    
 Worm    59 -----IPKGFALKIET----TADYDISKRDSIKFDDFYITSPAEKKIEY-AVRKTLPYNVVSKSG 113

  Fly   470 ---------------------AGGQ--NVTIE-------RLANGGAVMLR---SEMGL------- 494
                                 |.|.  |.|:|       |.||...|.|:   .|.|.       
 Worm   114 SLKFFATYTYVDISNYQQVIKATGTFFNTTLEANKFTTVRAANNDQVALKYGSRETGFHDETMYQ 178

  Fly   495 TLEWNGAGFL 504
            |..::|..|:
 Worm   179 TFVFDGNDFM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564
VWC 256..310 CDD:278520
VWC 319..376 CDD:214564 9/31 (29%)
VWD 371..536 CDD:214566 32/178 (18%)
C8 580..646 CDD:285899
irg-5NP_001366887.1 CUB_2 17..127 CDD:280554 25/139 (18%)
BBS2_N <209..278 CDD:405471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.