Sequence 1: | NP_524809.2 | Gene: | cv-2 / 45280 | FlyBaseID: | FBgn0000395 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366887.1 | Gene: | irg-5 / 185307 | WormBaseID: | WBGene00009429 | Length: | 343 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 41/205 - (20%) |
---|---|---|---|
Similarity: | 59/205 - (28%) | Gaps: | 76/205 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 346 TIRCAQMRCPAVKCRANEELKQ--PPGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYL 408
Fly 409 LASDCMGKTFHIRLTNEGRGTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVV---- 469
Fly 470 ---------------------AGGQ--NVTIE-------RLANGGAVMLR---SEMGL------- 494
Fly 495 TLEWNGAGFL 504 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cv-2 | NP_524809.2 | VWC | 184..243 | CDD:214564 | |
VWC | 256..310 | CDD:278520 | |||
VWC | 319..376 | CDD:214564 | 9/31 (29%) | ||
VWD | 371..536 | CDD:214566 | 32/178 (18%) | ||
C8 | 580..646 | CDD:285899 | |||
irg-5 | NP_001366887.1 | CUB_2 | 17..127 | CDD:280554 | 25/139 (18%) |
BBS2_N | <209..278 | CDD:405471 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |