DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and F19C6.3

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_509679.1 Gene:F19C6.3 / 184675 WormBaseID:WBGene00008952 Length:429 Species:Caenorhabditis elegans


Alignment Length:287 Identity:68/287 - (23%)
Similarity:95/287 - (33%) Gaps:99/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 WNDPE-------------DPCK---TYKCVATVVTETIQKCY--SQCD-------NNQLQPPRPG 175
            |..||             ..||   ..|..|...||.|::.|  |..|       ...:|.|   
 Worm   149 WKGPEPTQFLIGSGWPIGQKCKHDGVKKKYADAYTEKIERNYEPSAIDAINEIFFETVVQVP--- 210

  Fly   176 ECCPTCQGCKINGQTVAEGHEVDASIDDRCLVCQC-RGTQLTCSKKTCPVLPC--PMSKQIKRPD 237
               |...|||||...:    .::.:....|..|.| ....:.|....||.:.|  ||.    |.|
 Worm   211 ---PGFDGCKINNALL----NINETKTVNCNTCTCVDRDNVVCQAVDCPAVTCTHPMI----RKD 264

  Fly   238 ECCPRCPQNHSFLPVPGKCLF--NKSVYPEKTQFMPDRCTNCTCLNGT-------SVCQRPTCPI 293
            :|||.|.:         :|.:  :|...|....|.|..|..|.|.:..       :.|:.|:||.
 Worm   265 DCCPSCGE---------QCFYESHKIANPHGEVFWPGDCYRCQCWDKKVHCSSEYATCEPPSCPE 320

  Fly   294 LECAPEFQEPDGCCPR-------CAVAEVRS-----------ECSLDGIVYQNNETW-------- 332
            .:..  :.|...|||:       |||.....           :||.| ..:|.|.|:        
 Worm   321 EDWV--YNEKFNCCPKCRDFARFCAVKPCHKYATCTDSKRGPKCSCD-TGFQGNGTYCEDIDECS 382

  Fly   333 -------DMGPCRS---CRCNGGTIRC 349
                   .:|.|.|   ||...|:.:|
 Worm   383 FSQDAKEQLGGCLSGSTCRNVPGSYKC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 18/61 (30%)
VWC 256..310 CDD:278520 16/69 (23%)
VWC 319..376 CDD:214564 13/49 (27%)
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
F19C6.3NP_509679.1 VWC 216..270 CDD:214564 18/61 (30%)
EGF_3 346..375 CDD:289699 6/29 (21%)
EGF_CA 377..416 CDD:214542 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.