DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Chrd

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_011244116.1 Gene:Chrd / 12667 MGIID:1313268 Length:990 Species:Mus musculus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:96/248 - (38%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PPRPGECCPTCQGCKINGQTVAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKR 235
            |.||.:  |..  |...||....|.....:.|..|.:|.|:...:.|....||...||  ..::.
Mouse   733 PGRPRD--PNT--CFFEGQQRPHGARWAPNYDPLCSLCICQRRTVICDPVVCPPPSCP--HPVQA 791

  Fly   236 PDECCPRCP--QNHSFLP-----VPGK-CLF--NKSVYPEKTQFMP-------DRCTNCTCLNGT 283
            .|:|||.||  |....||     .||: |.|  ::|.....|::.|       .:|..|||...|
Mouse   792 LDQCCPVCPEKQRSRDLPSLPNLEPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGAT 856

  Fly   284 SV--CQRPTCPILECA-PEFQEPDGCCPRCAV-------------AEVRSECSLDGIVYQNNETW 332
            ..  |::..||.|.|| |....|..||.:|.|             |:....|...|..:..|::|
Mouse   857 GEVHCEKVQCPRLACAQPVRANPTDCCKQCPVGSGTNAKLGDPMQADGPRGCRFAGQWFPENQSW 921

  Fly   333 --------DMGPCRSCRCNGGTIRCAQMRC-PAVKCRANEELKQPPGECCQRC 376
                    :|. |.:|||..|...|.:..| |.:.|.:.:|     ..||..|
Mouse   922 HPSVPPFGEMS-CITCRCGAGVPHCERDDCSPPLSCGSGKE-----SRCCSHC 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 17/58 (29%)
VWC 256..310 CDD:278520 20/65 (31%)
VWC 319..376 CDD:214564 17/65 (26%)
VWD 371..536 CDD:214566 3/6 (50%)
C8 580..646 CDD:285899
ChrdXP_011244116.1 VWC 73..147 CDD:327433
CHRD 192..314 CDD:214804
CHRD 322..435 CDD:214804
CHRD 441..558 CDD:214804
CHRD 571..683 CDD:214804
VWC 742..799 CDD:327433 17/58 (29%)
VWC 820..886 CDD:214564 20/65 (31%)
VWC 908..968 CDD:327433 17/65 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.