DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and Chrd

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_006248619.1 Gene:Chrd / 117275 RGDID:620181 Length:970 Species:Rattus norvegicus


Alignment Length:256 Identity:69/256 - (26%)
Similarity:95/256 - (37%) Gaps:58/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PRPGECCPTCQG----------CKINGQTVAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLP 226
            |.|....|...|          |...||....|.....:.|..|.:|.|:...:.|....||...
  Rat   701 PGPEAPVPAKHGSSGRPRDPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPS 765

  Fly   227 CPMSKQIKRPDECCPRCP--QNHSFLP-----VPGK-CLF--NKSVYPEKTQFMP-------DRC 274
            ||  ..::..|:|||.||  |....||     .||: |.|  ::|.....|::.|       .:|
  Rat   766 CP--HPVQALDQCCPVCPEKQRSRDLPSLPNLEPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKC 828

  Fly   275 TNCTCLNGTSV--CQRPTCPILECA-PEFQEPDGCCPRCAV-------------AEVRSECSLDG 323
            ..|||...|..  |::..||.|.|| |....|..||.:|.|             |:....|...|
  Rat   829 AVCTCKGATGEVHCEKVQCPRLACAQPVRANPTDCCKQCPVGSGTHAKLGDPMQADGPRGCRFAG 893

  Fly   324 IVYQNNETW--DMGP-----CRSCRCNGGTIRCAQMRC-PAVKCRANEELKQPPGECCQRC 376
            ..:..|::|  .:.|     |.:|||..|...|.:..| |.:.|.:.:|     ..||..|
  Rat   894 QWFPENQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSPPLSCGSGKE-----SRCCSHC 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 17/58 (29%)
VWC 256..310 CDD:278520 20/65 (31%)
VWC 319..376 CDD:214564 17/64 (27%)
VWD 371..536 CDD:214566 3/6 (50%)
C8 580..646 CDD:285899
ChrdXP_006248619.1 VWC 73..147 CDD:302663
CHRD 192..295 CDD:214804
CHRD 303..416 CDD:214804
CHRD 422..539 CDD:214804
CHRD 552..664 CDD:214804
VWC 723..780 CDD:302663 17/58 (29%)
VWC 801..867 CDD:214564 20/65 (31%)
VWC 889..949 CDD:302663 17/64 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.