DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and crim1

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_002936419.1 Gene:crim1 / 100488895 XenbaseID:XB-GENE-481452 Length:1030 Species:Xenopus tropicalis


Alignment Length:532 Identity:117/532 - (21%)
Similarity:159/532 - (29%) Gaps:230/532 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DAGA-------GDSLSG----VRQSCSNEGEEVQLKNQPQIF--------TCFKCECQNGFVNCR 97
            |||:       ||...|    |.: |.||.:...:.|..:.:        .|..|.||.|...|.
 Frog   297 DAGSIPRIVSRGDGTPGKCCDVFE-CVNETKPACIFNNVEYYDGDMFRMDACRFCRCQGGVSICF 360

  Fly    98 DT-CPPVN-DCYILDKSNGTCCRRCK----------GCSFRGMSYESGSEWNDPEDPCKTYKCV- 149
            .. |..:: |.|.:.:  |.||..|:          ||...|.....|..|.  ||.|...:|: 
 Frog   361 SAQCGELHCDRYYVPE--GECCPVCEDPVYPVHDPAGCYANGQIRSHGDRWR--EDDCTFCQCIN 421

  Fly   150 ---ATVVTETIQKCYSQCDNNQLQPPR-PGECCPTCQ----------------GCKINGQTVAEG 194
               ..|.|...|.|        |:|.: ||||||.|:                .|.:..:....|
 Frog   422 GEPHCVATACGQSC--------LKPVKVPGECCPVCEEPTYITMAPPTCDMLINCTLTEKDCTYG 478

  Fly   195 HEVD----------------------ASID---------DRCLVCQCR----------------- 211
            ..:|                      .::|         ..|.:||||                 
 Frog   479 FRLDQNGCRTCQCKTREELCTGLISGCALDCPFGFQTHLHNCEICQCRPRPKKCKPLVCDKYCPF 543

  Fly   212 -------GTQLTCSKKTCPVLP----CPM-------------------------------SKQIK 234
                   |.: ||..|.||..|    |||                               |...:
 Frog   544 GYLKNKHGCE-TCRCKKCPDAPCSKMCPMGFEQDNHGCRVCKCREATTSVVPPVKTGTCLSMDGR 607

  Fly   235 R---------------------------------------PDECCPRCPQNH----------SFL 250
            |                                       |.:|||.||.:.          |..
 Frog   608 RHENEESWHDGCRECYCHNGKEMCGLITCPVPGCASPTIYPGQCCPSCPDDSNARNPELTDPSIC 672

  Fly   251 PVPGKCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGCCPRC----- 310
            ..||     ...:.|...:..|.||.|||.:|..:|:...||.|.|....:..|.|||:|     
 Frog   673 HAPG-----GEYFVEGETWNIDTCTQCTCHSGRVLCETEVCPPLLCQNPTRTQDSCCPQCPDDSL 732

  Fly   311 -----AVAEVRSECSLD-GIVYQNNETWDMGPCRSCRCNGGTIRCAQMRCPAVKCRANEELKQP- 368
                 :...:.|.|..| |.::...|:|....|.||.|..|.|.|....||.|.|      ::| 
 Frog   733 QPSVPSNESIPSYCKNDEGDIFLAAESWKPNVCTSCVCMDGIISCYSESCPPVTC------ERPV 791

  Fly   369 --PGECCQRCVE 378
              .|:||..|:|
 Frog   792 LRKGQCCPYCIE 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 25/187 (13%)
VWC 256..310 CDD:278520 17/53 (32%)
VWC 319..376 CDD:214564 20/60 (33%)
VWD 371..536 CDD:214566 4/8 (50%)
C8 580..646 CDD:285899
crim1XP_002936419.1 IB 30..>88 CDD:197525
VWC 329..383 CDD:214564 13/55 (24%)
VWC 396..449 CDD:214564 20/62 (32%)
Antistasin 532..557 CDD:367202 3/25 (12%)
Antistasin 560..585 CDD:367202 6/24 (25%)
VWC 605..655 CDD:327433 5/49 (10%)
VWC 676..727 CDD:327433 18/55 (33%)
VWC 751..801 CDD:327433 18/55 (33%)
VWC 812..866 CDD:327433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.