DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and vwc2l

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001122036.1 Gene:vwc2l / 100148652 ZFINID:ZDB-GENE-081104-169 Length:223 Species:Danio rerio


Alignment Length:131 Identity:40/131 - (30%)
Similarity:53/131 - (40%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 VYPEKTQFMP--DRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGCCPRCAVAEVRSECSLDGI 324
            ||....:|.|  ..|. |.|.....||.:|.||.:.......|.:||||.|  .||::.|...|.
Zfish    60 VYKLGERFFPGHSNCP-CVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPEC--KEVKNFCEYRGK 121

  Fly   325 VYQNNETWDMGPCRSCRCN-GGTIRCAQMRCPAVKCRANEELKQPPGECCQRCVE----TAGTCT 384
            .|:..|.:...||..|||. ...:.|....|...:| .|...:  |.:||..|..    .|||..
Zfish   122 TYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPEC-VNPVYE--PEQCCPICKNGPNCFAGTTI 183

  Fly   385 V 385
            :
Zfish   184 I 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564
VWC 256..310 CDD:278520 17/49 (35%)
VWC 319..376 CDD:214564 16/57 (28%)
VWD 371..536 CDD:214566 6/19 (32%)
C8 580..646 CDD:285899
vwc2lNP_001122036.1 VWC 116..171 CDD:302663 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.