DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and Ptp36E

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:212 Identity:68/212 - (32%)
Similarity:103/212 - (48%) Gaps:21/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 YIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPDEGR-SEQFGHARIQ 608
            ||.|||.:    ..||..:|.||||||...|||.||.::..|..|.:|||.... .||:|...|.
  Fly   170 YIVTQGPV----EETVQAYWRMVWQENISAIVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFIN 230

  Fly   609 CVSENSTSDYTLREFLVSWRDQ-----PARRIFHYHFQVWPDHGVPADPGCVLNFLQDVNTRQSH 668
            .|.|...:::.:|.|.:...::     ..|.|..:|:..|..|..|.. ..:|.|.:.|.....:
  Fly   231 IVREEQLANFHIRTFRLYKMNEKQEVTDERLILQFHYTEWYSHSCPFS-NALLEFRRRVRLVVGN 294

  Fly   669 LAQ-AGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTE---IDIQRTIQMVRSQRSGLV 729
            :.: ..:..|||.||||.|.||:|.::.||..|:      |..|   .::...::.:|..|.|||
  Fly   295 IIKDEDDMRGPILVHCSDGGGRSGVYMSIDANLE------LAEEEECFNVFGYLKKLRQSRKGLV 353

  Fly   730 QTEAQYKFVYYAVQHYI 746
            :...||||:|..::.:|
  Fly   354 ENVEQYKFIYDTLEEHI 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 67/208 (32%)
PTPc 543..743 CDD:238006 67/207 (32%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 67/208 (32%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.