DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and T27A3.5

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_491761.3 Gene:T27A3.5 / 188965 WormBaseID:WBGene00020841 Length:355 Species:Caenorhabditis elegans


Alignment Length:215 Identity:64/215 - (29%)
Similarity:102/215 - (47%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 YIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPDEGRSEQF---GHAR 606
            :|.|||    ....||.||:.::|||....:||.....|.||:||.:|||:....:..   |...
 Worm   141 FICTQG----PTEKTVDDFYRLIWQEKAPCVVMLCNIMECGKKKCEQYWPETADGQMILMDGKLT 201

  Fly   607 IQCV--SENSTSDYTLREFLVSWRDQPARRIFHYHFQVWPDHGVPADPGCVLNFLQDVNTRQSHL 669
            ::..  ::....:..|.:..|......:....|:.::.|||.|||..|..|...|..:.|     
 Worm   202 VKIAEPAKEVEQNILLMKITVIDDKGTSHNFEHWQWKAWPDRGVPELPMAVFRLLIRLKT----- 261

  Fly   670 AQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQRSGLVQTEAQ 734
                  ..||.|||||||||||:.:.:::.|   |:.....::.::..::.:|:||.|.|||:||
 Worm   262 ------ASPIVVHCSAGIGRTGSIVGLEIAL---VKFCAGEKVVLKDIVKEIRNQRHGSVQTDAQ 317

  Fly   735 YKFVYYAVQHYIQTLIARKR 754
            |.|:     |.:...:|..|
 Worm   318 YLFM-----HRVLLALAENR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 61/203 (30%)
PTPc 543..743 CDD:238006 61/202 (30%)
T27A3.5NP_491761.3 PTPc 73..326 CDD:214550 62/207 (30%)
PTPc 100..326 CDD:238006 62/207 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.