DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and F36H12.10

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_500756.1 Gene:F36H12.10 / 185396 WormBaseID:WBGene00018124 Length:398 Species:Caenorhabditis elegans


Alignment Length:227 Identity:73/227 - (32%)
Similarity:107/227 - (47%) Gaps:31/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 KTYIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPDEGRSEQFGHARI 607
            |.:|..||.|    ..|:.:||.||.|.....|||..|..|.||.|||:||| ..:.|:. ..:.
 Worm   172 KRFICAQGPL----DQTIDEFWWMVIQNKVEQIVMLCKTVEMGKLKCAQYWP-AAQGEKL-TLKS 230

  Fly   608 QCVSENSTS--------DYTLREFLVSWRDQPARRIFHYHFQVWPDHGVPADPGCVLNFLQDVNT 664
            .||.||.:.        :..:....:::.......:.|..:..|||.|||.   |.|..|:.:: 
 Worm   231 GCVVENVSGSKPMERDPEIQITMLNLTYSGGQTMSVRHLQWTEWPDRGVPP---CKLTSLELLS- 291

  Fly   665 RQSHLAQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQRSGLV 729
                 |..|.|. ||.||||||||||||.:.|:.||::|..|  .....:...::.:|.||:..:
 Worm   292 -----AIRGSKV-PIVVHCSAGIGRTGTIVAIEYILEKIAEN--KPCPPMPELVKALRDQRAFSI 348

  Fly   730 QTEAQYKFVY-----YAVQHYIQTLIARKRAE 756
            |.:.||.|::     |.::.|.:...|...||
 Worm   349 QNDVQYLFIHRVMLNYFLEKYKEKYAALLTAE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 69/213 (32%)
PTPc 543..743 CDD:238006 69/212 (33%)
F36H12.10NP_500756.1 PTPc 101..363 CDD:214550 68/208 (33%)
PTPc 133..363 CDD:238006 68/208 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.