DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and F38H4.4

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_502243.1 Gene:F38H4.4 / 178115 WormBaseID:WBGene00009548 Length:501 Species:Caenorhabditis elegans


Alignment Length:281 Identity:64/281 - (22%)
Similarity:117/281 - (41%) Gaps:70/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 KRHSNDSSGAVSISMAEREREREREMFKTYIATQGCLLTQ--QVNTVTDFWNMVWQENTR--VIV 576
            |.|.:||| .:..|..|.:.::.            .:|||  ..:|..|||.|:.::..:  :::
 Worm   241 KVHLSDSS-YIHASYLELDTQKR------------AILTQLPLPHTSADFWQMIIEQRVKCVLLL 292

  Fly   577 MTTKEYE---------RGKEKCARYWPDEGRSEQFGH-ARIQC-------VSENSTSDYTLREFL 624
            :|..||:         |.::    :...|.||.:.|. .|::.       |...|..||  :.||
 Worm   293 LTDSEYDSLGGDFVFPRNQD----FLNFEERSIRVGEFKRVEIMDGWVLKVVSVSNGDY--KSFL 351

  Fly   625 VSWRDQPARRIFH-YHFQVWPDHGVPAD--PGCVLNFLQDVNTRQSHLAQAGEKPGPICVHCS-A 685
                        | :|:..||.:.:|.:  |    .|::.:...||.|.:  ..|....|:.| :
 Worm   352 ------------HIHHYNAWPHNNIPGNGSP----KFVKQIWQLQSVLRK--YSPSTPTVYMSLS 398

  Fly   686 GIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQRSGLVQTEAQYKFVYYAVQHYI---- 746
            |.||.|||.:.:..  .:..:.....:|:.:.::|||:.|....|...|:.|||..:..:|    
 Worm   399 GCGRAGTFALFETA--HLSLHSEQATLDLVKCLEMVRNGRIHACQNLTQFSFVYTLLAEHILDNG 461

  Fly   747 --QTLIARKRAEEQSLQVGRE 765
              :..|.:|..:|:..:..:|
 Worm   462 FCKLAIPKKPNDEKDKEKDKE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 59/252 (23%)
PTPc 543..743 CDD:238006 52/224 (23%)
F38H4.4NP_502243.1 PTPc 214..455 CDD:214550 59/252 (23%)
PTPc 227..455 CDD:238006 59/252 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.