DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and F20H11.4

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_498458.1 Gene:F20H11.4 / 175937 WormBaseID:WBGene00017647 Length:446 Species:Caenorhabditis elegans


Alignment Length:264 Identity:76/264 - (28%)
Similarity:116/264 - (43%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 CLVGLLKRHS------------------------NDSSGAVSISMAEREREREREMFKTYIATQG 550
            |:...:|:||                        ||...|..::|.::.|         ||:.||
 Worm   134 CVADTMKKHSEKCRYYDILCPDATRVVLQNRPPDNDFIHANWMTMPDKFR---------YISAQG 189

  Fly   551 CLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPDEGR-SEQFGHARIQCVSENS 614
                ....||.|||:||:.|....:||.....|.|.:||:||.|.|.. |...|..||..:.:.:
 Worm   190 ----PMDQTVEDFWHMVYTEKAPAVVMICDWEEDGIQKCSRYIPSEDNISHVCGIYRITKIDQMT 250

  Fly   615 T--SDYTLREFLVSWRDQ----PARRIFHYHFQVWPDHGVPADPGCVLNFLQDVNTRQSHLAQAG 673
            .  :|..|:.|.:|..|:    |:..:.||||..|.||..|.....||..|:.:        :..
 Worm   251 MVYADVALQSFEISVTDKSLECPSLVVKHYHFLKWRDHTAPMTSISVLKLLKAL--------RDP 307

  Fly   674 EKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQRSGLVQTEAQYKFV 738
            ::|||..:|||||||||.|.|.:|....:|...|   |:::...::.:|..|...||:..|:.|:
 Worm   308 KRPGPPVIHCSAGIGRTATLIGVDYGNQRIGEVG---EMNVLDIVREMRQMRDKAVQSHHQFIFM 369

  Fly   739 YYAV 742
            ...:
 Worm   370 LMCI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 76/264 (29%)
PTPc 543..743 CDD:238006 67/207 (32%)
F20H11.4NP_498458.1 Y_phosphatase 142..375 CDD:278528 74/256 (29%)
PTPc 144..375 CDD:238006 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.