DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment csw and F47B3.7

DIOPT Version :9

Sequence 1:NP_477131.1 Gene:csw / 45278 FlyBaseID:FBgn0000382 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_491276.1 Gene:F47B3.7 / 171983 WormBaseID:WBGene00018531 Length:374 Species:Caenorhabditis elegans


Alignment Length:237 Identity:74/237 - (31%)
Similarity:124/237 - (52%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 KTYIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPD-EGRSEQF---G 603
            |.:|.|||    .:.:|:.|||.||.|:|...|:|..|..|..:.||.:|||. ||::..:   |
 Worm   131 KKFICTQG----PKDSTIYDFWAMVIQDNVESIIMLCKVIELARVKCEQYWPAVEGQTNTYVSKG 191

  Fly   604 HARIQCVSENSTSDYTLR---EFL------VSWRDQPARRIFHYHFQVWPDHGVPADPGCVLNFL 659
            |.    ::.|:....||.   :|:      :.|..: .|.|.||.:..|||||.|......:|.:
 Worm   192 HT----ITINNLGVGTLSPDDDFINVTNLELVWAGK-TRSITHYQWTNWPDHGAPPINMGAINLI 251

  Fly   660 QDVNTRQSHLAQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQ 724
            :.||          ....|:.||||||:||:||.:.|.:|:|:::: |::.: |:::.::.:|:|
 Worm   252 EAVN----------YDTNPVVVHCSAGVGRSGTIVGISLIMDKMIQ-GINCK-DMKKLVEEIRNQ 304

  Fly   725 RSGLVQTEAQYKFVYYAVQHYI--------QTLIARKRAEEQ 758
            |...:||||||.:::..:..|.        :.|:..|..||:
 Worm   305 RHYAIQTEAQYMYIHRVLLEYFLELHKETYEGLLLTKNYEEK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cswNP_477131.1 SH2_C-SH2_SHP_like 211..307 CDD:198185
PTPc 326..744 CDD:214550 69/213 (32%)
PTPc 543..743 CDD:238006 69/212 (33%)
F47B3.7NP_491276.1 Y_phosphatase 90..324 CDD:278528 69/213 (32%)
PTPc 92..324 CDD:238006 69/213 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2723
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.