DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psmb1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:198 Identity:41/198 - (20%)
Similarity:86/198 - (43%) Gaps:20/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FKFKGGVLLAV----------DSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLS 133
            :.|.||.:||:          |:|.:.|..|.::...|..::....:...:|...||:...:::.
  Rat    32 YAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIE 96

  Fly   134 KECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPG-LYYVDSEGSRTPGN 197
            ...::::..|.:.::..|.:.:::.|.:..:.....:..::.|.|:.|.| :|..|..||....:
  Rat    97 ARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDS 161

  Fly   198 LFSVGSGSLYAYGVLDS--GY-------HWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIK 253
            ..:.||.|.....:||:  |:       |..|....|..|.:.....|..||.|:|..:|:..:.
  Rat   162 FKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVT 226

  Fly   254 EDG 256
            ::|
  Rat   227 KEG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 41/198 (21%)
proteasome_beta_type_5 74..261 CDD:239730 41/198 (21%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 41/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.