DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PRE1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:43/186 - (23%)
Similarity:82/186 - (44%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHEL 141
            ||.:.:..|:||.....|.|..:...|..|..:::...|.:.||.|.|.|.:...:....:|:.:
Yeast     5 LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSI 69

  Fly   142 RNKERISVAAASK-IMANIAHEYKG-MGLSMGMMLAGYDKR--GPGLYYVDSEGSRTPGNLFSVG 202
            |....:|..|.|. :...:|...:. ....:.:::.||||:  .|.||.:|..|::......:.|
Yeast    70 REDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHG 134

  Fly   203 SGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDA--YSGGIIRVYHIKEDG 256
            ....|.:.:||..|..|:..:|..:|.:..:.....|..  :.|.|:::  :.:||
Yeast   135 YSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKI--VDKDG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 43/186 (23%)
proteasome_beta_type_5 74..261 CDD:239730 43/186 (23%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 43/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.