DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PRE10

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_015007.1 Gene:PRE10 / 854544 SGDID:S000005889 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:52/232 - (22%)
Similarity:93/232 - (40%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKE 135
            ::|||::|.|...||:.||:...|....:..:::|  :::....:|        |||...:... 
Yeast    32 ENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVK--IQVVDRHIG--------CVYSGLIPDG- 85

  Fly   136 CRLHELRNKERISVAAASKI---------MANIAHEY----------KGMGLSMGMMLAGYDKRG 181
               ..|.|:.|...|:..|:         .|:...:|          :..|:|  .:..|.||.|
Yeast    86 ---RHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVS--TIFGGVDKNG 145

  Fly   182 PGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDS--GYHWD-LEDKEAQELGRRAIYHATFRDAYS 243
            ..||.::..||.......:.|.|...|...|:.  .:|.: |..:||.:...:.||.     |:.
Yeast   146 AHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYL-----AHE 205

  Fly   244 GGIIRVYHIKEDGWVNISNTDCMELHYMYQEQLKQQA 280
            ....:.:.: |..|.::|.|:  .||...:..|.|:|
Yeast   206 DNKEKDFEL-EISWCSLSETN--GLHKFVKGDLLQEA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 49/222 (22%)
proteasome_beta_type_5 74..261 CDD:239730 44/208 (21%)
PRE10NP_015007.1 proteasome_alpha_type_3 5..219 CDD:239720 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.