DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PUP1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:65/210 - (30%)
Similarity:101/210 - (48%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKK 106
            :|...|:|  :..|...|....|..|.. ..|||.:|.||..||::|.|:|:|.|..:..::..|
Yeast     1 MAGLSFDN--YQRNNFLAENSHTQPKAT-STGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAK 62

  Fly   107 IVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMG 171
            :..|:..:....||.|||.....:::.....||.|.......|.:|.:::.....:|:| .:...
Yeast    63 LHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQG-HIGAY 126

  Fly   172 MMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHW--DLEDKEAQELGRRAIY 234
            :::||.|..|..|:.:.:.||...|...|:|||||.|..||:|  ||  ||..:||.:|...||.
Yeast   127 LIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLES--HWKQDLTKEEAIKLASDAIQ 189

  Fly   235 HATFRDAYSGGIIRV 249
            ...:.|..||..:.|
Yeast   190 AGIWNDLGSGSNVDV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 65/210 (31%)
proteasome_beta_type_5 74..261 CDD:239730 57/178 (32%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 57/178 (32%)
Pr_beta_C 223..257 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.