DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PBC2

DIOPT Version :10

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_565156.1 Gene:PBC2 / 844080 AraportID:AT1G77440 Length:204 Species:Arabidopsis thaliana


Alignment Length:200 Identity:45/200 - (22%)
Similarity:88/200 - (44%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FKFKGGVLLAV----------DSRATGGSYIGSQ------SMKKIVEINQFMLGTLAGGAADC-V 126
            |::.|..::|:          |.|      :|.|      ..::|.:|:..:...|:|.|.|. .
plant     4 FEYNGSAVVAMVGKNCFAIASDRR------LGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQT 62

  Fly   127 YWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGY-DKRGPGLYYVDSE 190
            .:.|::.:. :|::||.:..:.....:.:::.|.:|.:........::||. |...|.:..:||.
plant    63 LYQRLVFRH-KLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFICTMDSI 126

  Fly   191 GSRTPGNLFSV-GSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVY---- 250
            |::.....|.| |:.|...||..::.:..|:|.:|..|...:|:..:..||..||....||    
plant   127 GAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTP 191

  Fly   251 -HIKE 254
             .:||
plant   192 KEVKE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 proteasome_beta_type_5 74..261 CDD:239730 44/199 (22%)
PBC2NP_565156.1 proteasome_beta_type_3 6..200 CDD:239728 43/197 (22%)

Return to query results.
Submit another query.