DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and psma6l

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:173 Identity:37/173 - (21%)
Similarity:64/173 - (36%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGV--LLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKE 135
            |.||:|.:   ||  .:.|..:....:.:.:.:|     .|.|.:....|    ||.........
Zfish    36 GLTTVGIR---GVDCAVLVTQKKVSDTLLDASTM-----TNMFRITPRIG----CVMTGHYADSR 88

  Fly   136 CRLHELRNKE---------RISVAAASKIMANIAHEY------KGMGLSMGMMLAGYDKRGPGLY 185
            .::|..|.:.         .:.|.|..:.:|:::..|      :.:|..| |:::...::||.||
Zfish    89 SQVHRARIEAGEWKYKFGYDVPVDALCRRLADLSQVYTQNAEMRPLGCCM-MLISMDPQKGPMLY 152

  Fly   186 YVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQEL 228
            ..|..|........|||.....|...|:.......:.||..||
Zfish   153 KCDPAGYFCGFRATSVGVKHTEANSYLEKKIKKMQKKKEEVEL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 37/173 (21%)
proteasome_beta_type_5 74..261 CDD:239730 36/172 (21%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 37/173 (21%)
proteasome_alpha_type_6 8..226 CDD:239723 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.