DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and AT3G26340

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_189265.1 Gene:AT3G26340 / 822238 AraportID:AT3G26340 Length:273 Species:Arabidopsis thaliana


Alignment Length:247 Identity:136/247 - (55%)
Similarity:171/247 - (69%) Gaps:9/247 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKI 107
            :||.|:.|  ..........|....:....|||||.|.||.||::|.||||:.|.||.|||:|||
plant    29 SAPSFDLP--RTTDFDGFQKKAVEMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI 91

  Fly   108 VEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGM 172
            :|||.:||||:|||||||.:|.|.|..:||||||.||.||||:.|||::||:.:.|:|||||:|.
plant    92 IEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGT 156

  Fly   173 MLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHAT 237
            |:||:|:.||||||||:||.|..|:.|||||||.||||||||||.:|:..:||.||.||:|||||
plant   157 MIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHAT 221

  Fly   238 FRDAYSGGIIRVYHIKEDGWVNISNTDCMELHYMY-------QEQLKQQAAK 282
            |||..|||:..|||:...||..:|..|..||||.|       .|.:.::||:
plant   222 FRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPITAEHVMEEAAE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 132/228 (58%)
proteasome_beta_type_5 74..261 CDD:239730 120/186 (65%)
AT3G26340NP_189265.1 proteasome_beta_type_5 58..245 CDD:239730 120/186 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 254 1.000 Domainoid score I500
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55690
Inparanoid 1 1.050 274 1.000 Inparanoid score I897
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D929961at2759
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm956
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.