DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PAE2

DIOPT Version :10

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_188046.1 Gene:PAE2 / 820649 AraportID:AT3G14290 Length:237 Species:Arabidopsis thaliana


Alignment Length:168 Identity:49/168 - (29%)
Similarity:87/168 - (51%) Gaps:18/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECR 137
            |:|.:|.|.|.||:|||:.|.| ...:...|::||:||:..:...::|..||.    |.|.:..|
plant    34 GSTAIGVKTKEGVVLAVEKRIT-SPLLEPSSVEKIMEIDDHIGCAMSGLIADA----RTLVEHAR 93

  Fly   138 L----HELRNKERISVAAASKIMANIAHEYKGMG--------LSMGMMLAGYDKRGPGLYYVDSE 190
            :    |.....|.::|.:.::.:.::|..: |.|        ..:.:::||:|:.||.|||.|..
plant    94 VETQNHRFSYGEPMTVESTTQALCDLALRF-GEGEEESMSRPFGVSLLIAGHDENGPSLYYTDPS 157

  Fly   191 GSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQEL 228
            |:....|..::||||..|...|...::.|:..:||:.:
plant   158 GTFWQCNAKAIGSGSEGADSSLQEQFNKDITLQEAETI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 proteasome_beta_type_5 74..261 CDD:239730 48/167 (29%)
PAE2NP_188046.1 proteasome_alpha_type_5 8..218 CDD:239722 49/168 (29%)

Return to query results.
Submit another query.