DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and psmb7

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021324576.1 Gene:psmb7 / 64278 ZFINID:ZDB-GENE-001208-4 Length:286 Species:Danio rerio


Alignment Length:179 Identity:61/179 - (34%)
Similarity:90/179 - (50%) Gaps:5/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKI--VEINQFMLGTLAGGAADCVYWDRVLSKE 135
            |||..|..:|.||:|..|:|||.|..:..::..||  :..|.:..|  ||.|||.....:::|..
Zfish    43 GTTICGIVYKDGVVLGADTRATEGMIVADKNCSKIHYISPNIYCCG--AGTAADTEMTTQIISSN 105

  Fly   136 CRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFS 200
            ..||.|.......||.|::::..:...|:|. :...::|.|.|..||.||.:...||.......:
Zfish   106 LELHSLSTGRLPRVATANRMLKQMLFRYQGY-IGAALVLGGVDCTGPHLYSIYPHGSTDKLPYVT 169

  Fly   201 VGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRV 249
            :|||||.|..|.:..|..|:|:::|:.|.|.||....|.|..||..|.|
Zfish   170 MGSGSLAAMAVFEDRYRPDMEEEDAKSLVRDAIAAGIFNDLGSGSNIDV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 61/179 (34%)
proteasome_beta_type_5 74..261 CDD:239730 60/178 (34%)
psmb7XP_021324576.1 proteasome_beta_type_7 44..232 CDD:239732 60/178 (34%)
Pr_beta_C 237..280 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.