DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PSMB7

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:213 Identity:67/213 - (31%)
Similarity:102/213 - (47%) Gaps:13/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 APP-----FENPLHNLNQIQANGDKTGVKIN--FDHGTTTLGFKFKGGVLLAVDSRATGGSYIGS 101
            |||     |:|...|. .::|:..|.|.|:.  ...|||..|..:|.|::|..|:|||.|..:..
Human     8 APPVGGFSFDNCRRNA-VLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVAD 71

  Fly   102 QSMKKI--VEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYK 164
            ::..||  :..|.:..|  ||.|||.....:::|....||.|.......|..|::::..:...|:
Human    72 KNCSKIHFISPNIYCCG--AGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQ 134

  Fly   165 GMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELG 229
            |. :...::|.|.|..||.||.:...||.......::|||||.|..|.:..:..|:|::||:.|.
Human   135 GY-IGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLV 198

  Fly   230 RRAIYHATFRDAYSGGII 247
            ..||....|.|..||..|
Human   199 SEAIAAGIFNDLGSGSNI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 67/213 (31%)
proteasome_beta_type_5 74..261 CDD:239730 56/176 (32%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 56/176 (32%)
Pr_beta_C 236..271 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.