DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and PSMB5

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_002788.1 Gene:PSMB5 / 5693 HGNCID:9542 Length:263 Species:Homo sapiens


Alignment Length:238 Identity:137/238 - (57%)
Similarity:190/238 - (79%) Gaps:13/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLANPYTLAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYI 99
            :|::..:||||.:..|           ::.|:::.  ||||||.|||:.||::|.|||||.|:||
Human    34 SLSDGLSLAAPGWGVP-----------EEPGIEML--HGTTTLAFKFRHGVIVAADSRATAGAYI 85

  Fly   100 GSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYK 164
            .||::||::|||.::|||:|||||||.:|:|:|:::||::|||||||||||||||::||:.::||
Human    86 ASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK 150

  Fly   165 GMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELG 229
            |||||||.|:.|:||||||||||||||:|..|..|||||||:|||||:|.||.:|||.::|.:|.
Human   151 GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLA 215

  Fly   230 RRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHYMY 272
            |||||.||:|||||||.:.:||::||||:.:|:.:..:||..|
Human   216 RRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 135/233 (58%)
proteasome_beta_type_5 74..261 CDD:239730 124/186 (67%)
PSMB5NP_002788.1 proteasome_beta_type_5 60..247 CDD:239730 124/186 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 273 1.000 Domainoid score I1789
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55690
Inparanoid 1 1.050 295 1.000 Inparanoid score I2756
Isobase 1 0.950 - 0 Normalized mean entropy S454
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm8519
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1013
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.