DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:202 Identity:58/202 - (28%)
Similarity:105/202 - (51%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGG 121
            :|.:.|.|...::  .|||.:..:|.|||::..|||.:.|:|:.::...|:..|...:....:|.
  Fly     1 MQPDFDFTDTPVS--TGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGS 63

  Fly   122 AADCVYWDRVLSKECRLHELR-NKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYD-KRGPGL 184
            |||......:::.....||.: ||:.:...|||: ..|..:.|: ..|..|:::||:| :||..:
  Fly    64 AADTQAIADIVAYSLNYHENQTNKDALVFEAASE-FRNYCYSYR-ESLLAGIIVAGWDEQRGGQV 126

  Fly   185 YYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRV 249
            |.:...|..|..:....||||.:.||.:...|..::..::.....::|:.||.:.|..|||::|:
  Fly   127 YSIPLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRI 191

  Fly   250 YHIKEDG 256
            ..|.:||
  Fly   192 GIITKDG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 58/202 (29%)
proteasome_beta_type_5 74..261 CDD:239730 54/185 (29%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 55/186 (30%)
proteasome_beta_type_6 16..203 CDD:239731 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440961
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.