DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and psmb8

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_012809693.1 Gene:psmb8 / 445258 XenbaseID:XB-GENE-479064 Length:281 Species:Xenopus tropicalis


Alignment Length:234 Identity:132/234 - (56%)
Similarity:174/234 - (74%) Gaps:2/234 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKK 106
            ||.||...|...|..::...|  .|||...||||||.|||:.||::||||||:.||||.:....|
 Frog    37 LAVPPGYQPAKFLEHLEEGVD--DVKIEPWHGTTTLAFKFQHGVIVAVDSRASAGSYISNVKFNK 99

  Fly   107 IVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMG 171
            ::|||.::|||::|.||||.||:|||:|||||::|||..||||:||||:|.|:..:|:|.|||:|
 Frog   100 VIEINPYLLGTMSGSAADCQYWERVLAKECRLYQLRNNSRISVSAASKLMCNMMLQYRGTGLSVG 164

  Fly   172 MMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHA 236
            .|:.|:||:|||||||:..|:|..|::||.|||:.|||||:||||.:||..:||.:||||||.:|
 Frog   165 SMICGWDKKGPGLYYVNDNGTRLCGDIFSTGSGNSYAYGVMDSGYRYDLTPEEAYDLGRRAISYA 229

  Fly   237 TFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHYMYQEQ 275
            |.|||||||.:.:||:||||||.|...|..:|.:.|.|:
 Frog   230 THRDAYSGGFVNLYHMKEDGWVKIGQFDVNDLLHKYTEE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 130/229 (57%)
proteasome_beta_type_5 74..261 CDD:239730 115/186 (62%)
psmb8XP_012809693.1 proteasome_beta_type_5 67..254 CDD:239730 115/186 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1013
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.