Sequence 1: | NP_652014.1 | Gene: | Prosbeta5 / 45269 | FlyBaseID: | FBgn0029134 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002543.2 | Gene: | psmb10 / 436816 | ZFINID: | ZDB-GENE-040718-278 | Length: | 276 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 62/202 - (30%) |
---|---|---|---|
Similarity: | 93/202 - (46%) | Gaps: | 8/202 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 FENPLHNLNQIQANGDKTGVKINFDH--GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKI-- 107
Fly 108 VEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGM 172
Fly 173 MLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHAT 237
Fly 238 FRDAYSG 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta5 | NP_652014.1 | PTZ00488 | 38..272 | CDD:185666 | 62/202 (31%) |
proteasome_beta_type_5 | 74..261 | CDD:239730 | 54/173 (31%) | ||
psmb10 | NP_001002543.2 | PRE1 | 40..224 | CDD:223711 | 55/176 (31%) |
proteasome_beta_type_7 | 43..231 | CDD:239732 | 54/173 (31%) | ||
Pr_beta_C | 237..270 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |