DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and psmb10

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:202 Identity:62/202 - (30%)
Similarity:93/202 - (46%) Gaps:8/202 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FENPLHNLNQIQANGDKTGVKINFDH--GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKI-- 107
            |||...|. .::||..:.|.......  |||..|..||.||:|..|:|||....:..::..||  
Zfish    15 FENTRRNA-VLEANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHY 78

  Fly   108 VEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGM 172
            :..|.:..|  ||.|||.....:::|....||.|.......||..::.:..:...|:| .:...:
Zfish    79 IAPNIYCCG--AGVAADAEVTTQMMSSNVELHSLSTGRPPLVAMVTRQLKQMLFRYQG-HIGSSL 140

  Fly   173 MLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHAT 237
            ::.|.|..|..||.|...||.......::|||:..|..|.:..|..::|.:||::|.|.||....
Zfish   141 IVGGVDVNGAQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAITAGI 205

  Fly   238 FRDAYSG 244
            |.|..||
Zfish   206 FCDLGSG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 62/202 (31%)
proteasome_beta_type_5 74..261 CDD:239730 54/173 (31%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 55/176 (31%)
proteasome_beta_type_7 43..231 CDD:239732 54/173 (31%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.