DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosalpha3T

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster


Alignment Length:271 Identity:54/271 - (19%)
Similarity:98/271 - (36%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TLAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMK 105
            |:.:|  |..|:.:........::|         |.:|...|.|||||.: |:.......|..:.
  Fly    10 TIFSP--EGRLYQVEYAMEAASQSG---------TCVGLLAKNGVLLATE-RSVDKLMDTSIPVP 62

  Fly   106 KIVEINQFMLGTLAGGAADCVYWDRVLSKECRL----HELRNKERISVAAASKIMANIAHEYKGM 166
            :|..:|:.:.....|..||    ..||..:.|:    ::....|.|........:.:|...|...
  Fly    63 RISWLNENIACCATGNTAD----GNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQY 123

  Fly   167 G----LSMGMMLAGYDKR-GPGLYYVDSEGSRTPGNLFSVG--SGS--------LYAYGVLDSGY 216
            |    ..:..:..|:|.| |..||..|..|:.:......:|  ||:        |::.|.:....
  Fly   124 GGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV 188

  Fly   217 HWDLEDKEAQELGRRAIYHATFRDAYSG-----------GIIRVYHIKEDGWVNISNTDCMELHY 270
                  :||:::..:.:.....||:.:.           |...|:||.|..          |:|.
  Fly   189 ------EEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKN----------EIHR 237

  Fly   271 MYQ--EQLKQQ 279
            :.:  ..||::
  Fly   238 LIERNNNLKRR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 52/260 (20%)
proteasome_beta_type_5 74..261 CDD:239730 45/216 (21%)
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 52/262 (20%)
Ntn_hydrolase 3..218 CDD:294319 45/229 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.