DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:94/201 - (46%) Gaps:24/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FKFKGGVLLAV----------DSRATGGSYIGSQSMKKIVEIN-QFMLGTLAGGAADCVYWDRVL 132
            ::..||.::|:          |:|.:.|..|.|::..|:.::: |.:||: ||..||.:.....:
  Fly    25 YESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGS-AGCWADTLSLTGSI 88

  Fly   133 SKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYY-VDSEGSRTPG 196
            ....:.:|..:...::..|.:::::...:..:.....:..:|||.|..|.|:.| .|..|.....
  Fly    89 KVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKA 153

  Fly   197 NLFSVGSGSLYAYGVLDS--GY-HWDLEDKEAQELGR-RAIYHA--TF-----RDAYSGGIIRVY 250
            ...:.|:.......|||:  |: :.:|||.:..:|.: ||:..|  ||     ||.|:|..:.:.
  Fly   154 TYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLIN 218

  Fly   251 HIKEDG 256
            .|.:||
  Fly   219 IITKDG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 48/201 (24%)
proteasome_beta_type_5 74..261 CDD:239730 48/201 (24%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/201 (24%)
PRE1 24..225 CDD:223711 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.