DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:184 Identity:62/184 - (33%)
Similarity:97/184 - (52%) Gaps:5/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKI--VEINQFMLGTLAGGAADCVYWDRVLSKE 135
            |||.:|..:|.||:|..|:|||.|..:..::..||  :..|.:..|  ||.|||......::|.:
  Fly    39 GTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCG--AGTAADTEMTTDLISSQ 101

  Fly   136 CRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFS 200
            ..||.|:....:.|.||:.::..:...|:| .:|..::|.|.||.||.:|.:...||.......:
  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRYQG-HISAALVLGGVDKTGPHIYSIHPHGSSDKLPYAT 165

  Fly   201 VGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKE 254
            :|||||.|..|.:|.:..||.::|.::|.|.||....|.|..||..|.:..|::
  Fly   166 MGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 62/184 (34%)
proteasome_beta_type_5 74..261 CDD:239730 61/183 (33%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 59/181 (33%)
proteasome_beta_type_7 42..228 CDD:239732 59/181 (33%)
Pr_beta_C 232..264 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440966
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.