DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:179 Identity:46/179 - (25%)
Similarity:72/179 - (40%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKEC 136
            |..|.||...:.|:|||.:.|:|......:...:||..:|..|:.::||..:|.    .||:.|.
  Fly    30 HAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDA----NVLTSEL 90

  Fly   137 RL----HELRNKERISVAAASKIMANIAHEYKGMG----LSMGMMLAGYD-KRGPGLYYVDSEGS 192
            ||    ::....|.|........:.:|...|...|    ..:.::..|:| |.|..||..|..|:
  Fly    91 RLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGN 155

  Fly   193 RTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDA 241
            ........:|:.    :|...|....:|.|||..:|        |..||
  Fly   156 YGGWKATCIGNN----FGAAISMLKQELADKENVKL--------TLADA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 46/179 (26%)
proteasome_beta_type_5 74..261 CDD:239730 45/177 (25%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 46/179 (26%)
proteasome_alpha_type_4 3..219 CDD:239721 46/179 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.