DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psma8

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:116/260 - (44%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LANPYTLAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIG 100
            :|:.|..|...| :|..:|.|::.  .:..||    .|:|.:|.:....|:|.|:.::. .....
  Rat     1 MASRYDRAITVF-SPDGHLFQVEY--AQEAVK----KGSTAVGIRGTNIVVLGVEKKSV-AKLQD 57

  Fly   101 SQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSK---ECRLHELRNKERISVAAASKIMANIAHE 162
            .::::||..::..:....||..||...   |:|:   ||:.|:|..::.::|...::.:|.:..:
  Rat    58 ERTVRKICALDDHVCMAFAGLTADARV---VISRARVECQSHKLTVEDPVTVEYITRFIATLKQK 119

  Fly   163 Y------KGMGLSMGMMLAGYDKRG-PGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDL 220
            |      :..|:|  .::.|:|..| |.||..|..|:.......::|..:......|:..|..|.
  Rat   120 YTQSNGRRPFGIS--ALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDA 182

  Fly   221 --EDKEAQELGRRAIYHATFRDAYSGG-IIRVYHIKEDGWVNISNTDCMELHYMYQEQLKQQAAK 282
              .|.||.:|..:|:...    ..||| .|.:..|:.|..:.:.:...:||.....|:.|.:|.|
  Rat   183 ISNDNEAIKLAIKALLEV----VQSGGKNIELAIIRRDQPLKMFSAKEIELEVTEIEREKDEAEK 243

  Fly   283  282
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 56/246 (23%)
proteasome_beta_type_5 74..261 CDD:239730 45/199 (23%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 56/245 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 52/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.