DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:205 Identity:46/205 - (22%)
Similarity:82/205 - (40%) Gaps:34/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MCNLANPYTLAAPPF--ENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATG 95
            |..:...|.|:|..|  :..:..::......:|:|         |.:|.:.|..|:|||:...|.
  Fly     1 MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSG---------TVIGIRGKDAVVLAVEKIITS 56

  Fly    96 GSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIA 160
            ..| ...:..:|..|.:.:...:||..||..:...:..:|...:..:.::.|.:......:|...
  Fly    57 KLY-EPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYV 120

  Fly   161 HEY------KGMGLSMGMMLAGYDK-RGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHW 218
            |.|      :..|||  ::||.:|: .||.||.::.             |||.:.|....||...
  Fly   121 HAYTLYSAVRPFGLS--IILASWDEVEGPQLYKIEP-------------SGSSFGYFACASGKAK 170

  Fly   219 DLEDKEAQEL 228
            .|...|.::|
  Fly   171 QLAKTEMEKL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 45/200 (23%)
proteasome_beta_type_5 74..261 CDD:239730 39/162 (24%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 45/201 (22%)
PRE1 6..231 CDD:223711 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.