DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:175 Identity:41/175 - (23%)
Similarity:74/175 - (42%) Gaps:26/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAAD----CVYWDRVLS 133
            |..|:|.|.....:||...|.:..:   :...:||:.::..:..::||..||    |.|    :.
  Fly    32 GAATVGLKGTDYAVLAALCRTSKDT---NTLQRKIMPVDDHVGMSIAGLTADARVVCQY----MR 89

  Fly   134 KECRLHELRNKERISVAAASKIMANIAHE-------YKGMGLSMGMMLAGYDKRGPGLYYVDSEG 191
            .||..:.........|   .::::|:.::       |......:|:::||||::||.:|.|....
  Fly    90 TECMAYRHSYNAEFPV---RRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPTA 151

  Fly   192 SRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHA 236
            :.......::||.|..|...|:.... ..||.:..||    |.||
  Fly   152 NVLNCKAMAIGSRSQSARTYLERNME-SFEDCDMDEL----ICHA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 41/175 (23%)
proteasome_beta_type_5 74..261 CDD:239730 40/174 (23%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 41/175 (23%)
proteasome_alpha_type_1 6..215 CDD:239718 41/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.