DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:213 Identity:42/213 - (19%)
Similarity:84/213 - (39%) Gaps:42/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECR 137
            |:|.:|.:....|:|.|:.::. ......:.::||..::..::...||..||..........||:
  Fly    31 GSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94

  Fly   138 LHELRNKERISVAAASKIMANIAHEY------KGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPG 196
            .|.|..::.:::...::.:|.:..:|      :..|:|  .::.|:          |::||   .
  Fly    95 SHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS--CLIGGF----------DADGS---A 144

  Fly   197 NLFSV-GSGSLYAYGVLDSGYHWDLEDKEAQELGRRA-IYHATFRDAYSGGIIRVYHIKEDGWVN 259
            :||.. .||..|.|              :|...||.| :....|..:|....:    ..|.|.|.
  Fly   145 HLFQTEPSGIFYEY--------------KANATGRSAKVVREFFEKSYREEEV----ANEHGAVK 191

  Fly   260 ISNTDCMELHYMYQEQLK 277
            ::....:|:....|..|:
  Fly   192 LAIRALLEVAQSGQNNLE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 40/206 (19%)
proteasome_beta_type_5 74..261 CDD:239730 38/194 (20%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 42/213 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.