DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:280 Identity:145/280 - (51%)
Similarity:195/280 - (69%) Gaps:4/280 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALAEICKISNAPYMRPNAW-SSADVEEEQKGLMCNLANPYTLAAPPFENPLHNLNQIQANGDKT 64
            |||..||.:...|:|:...: :|....||.:....|:.||..:.|||:|||..::.::.|..:  
  Fly     1 MALESICGMDKLPFMKSFGYRTSKQTIEEIRVASSNMDNPLAIMAPPYENPRESVKKLNALSE-- 63

  Fly    65 GVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWD 129
             |:|:|||||||:||.::||::|.||||||.|..|||||:.|:|::||:::||.|||||||.|||
  Fly    64 -VQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWD 127

  Fly   130 RVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRT 194
            |.|::||||||||.|||:.|.:|:|.::|:|.|||||||.|||||||:...||.|.||||.|.|.
  Fly   128 RALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRI 192

  Fly   195 PGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVN 259
            .|.||:||||:..|.|:|||.|..||.|.||.:|...|:||||..|.:|||::|:||:.:..|.|
  Fly   193 HGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMDQGNWRN 257

  Fly   260 ISNTDCMELHYMYQEQLKQQ 279
            ::|.||.|||..|.....||
  Fly   258 VANKDCQELHEQYSGVGNQQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 131/233 (56%)
proteasome_beta_type_5 74..261 CDD:239730 110/186 (59%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 131/235 (56%)
proteasome_beta_type_5 72..259 CDD:239730 110/186 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448427
Domainoid 1 1.000 200 1.000 Domainoid score I1766
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I897
Isobase 1 0.950 - 0 Normalized mean entropy S454
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm6525
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
1211.750

Return to query results.
Submit another query.