DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psmb3

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_036101.1 Gene:Psmb3 / 26446 MGIID:1347014 Length:205 Species:Mus musculus


Alignment Length:187 Identity:46/187 - (24%)
Similarity:85/187 - (45%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKEC 136
            :|...:..|.|..|.:|.|.|....:.:.:...:||..:...:...|||.|.|.....:.|....
Mouse     7 NGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRL 71

  Fly   137 RLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKR--GPGLYYVDSEGSRTPGNLF 199
            .|:||:...:|.......::||:.:|.:........::||.|.:  .|.:..:|..|.....:.|
Mouse    72 NLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDF 136

  Fly   200 SV-GSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKED 255
            .| |:.|...||:.:|.:..:::.:...|...:|:.:|..|||.||..:.|:.|::|
Mouse   137 VVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAVSGMGVIVHVIEKD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 46/187 (25%)
proteasome_beta_type_5 74..261 CDD:239730 45/185 (24%)
Psmb3NP_036101.1 proteasome_beta_type_3 6..201 CDD:239728 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.