DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psma1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:160 Identity:36/160 - (22%)
Similarity:61/160 - (38%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQS-----MKKIVEINQFMLGTLAGGAADCVYWDRVL 132
            |:.|:|.|.|...:|....||        ||     .|||:.::..:..::||..||.......:
Mouse    32 GSATVGLKSKTHAVLVALKRA--------QSELAAHQKKILHVDNHIGISIAGLTADARLLCNFM 88

  Fly   133 SKEC--------------RLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPG 183
            .:||              ||..|       :.:.::|.   ...|......:|:::||||..||.
Mouse    89 RQECLDSRFVFDRPLPVSRLVSL-------IGSKTQIP---TQRYGRRPYGVGLLIAGYDDMGPH 143

  Fly   184 LYYVDSEGSRTPGNLFSVGSGSLYAYGVLD 213
            ::......:.......|:|:.|..|...|:
Mouse   144 IFQTCPSANYFDCRAMSIGARSQSARTYLE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 36/160 (23%)
proteasome_beta_type_5 74..261 CDD:239730 35/159 (22%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 36/160 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.