DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psma1

DIOPT Version :10

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:155 Identity:35/155 - (22%)
Similarity:62/155 - (40%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKEC- 136
            |:.|:|.|.|...:|....||.  |.:.:. .|||:.::..:..::||..||.......:.:|| 
Mouse    32 GSATVGLKSKTHAVLVALKRAQ--SELAAH-QKKILHVDNHIGISIAGLTADARLLCNFMRQECL 93

  Fly   137 -------------RLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVD 188
                         ||..|       :.:.::|.   ...|......:|:::||||..||.::...
Mouse    94 DSRFVFDRPLPVSRLVSL-------IGSKTQIP---TQRYGRRPYGVGLLIAGYDDMGPHIFQTC 148

  Fly   189 SEGSRTPGNLFSVGSGSLYAYGVLD 213
            ...:.......|:|:.|..|...|:
Mouse   149 PSANYFDCRAMSIGARSQSARTYLE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 proteasome_beta_type_5 74..261 CDD:239730 34/154 (22%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 35/155 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.