DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and pts1

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_593825.1 Gene:pts1 / 2543623 PomBaseID:SPAC4A8.13c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:133/244 - (54%)
Similarity:170/244 - (69%) Gaps:16/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VEEEQKGLMCNLANPYTLAAPPFEN-PLHNLNQIQANGDKTGVK---INFDHGTTTLGFKFKGGV 85
            :|||      ...|.:.:...|..: .|.||.      |:|..|   |..:||||||.|:::.|:
pombe    21 IEEE------GFTNRFDVVPVPQSSLYLRNLT------DETKNKHCLIKMNHGTTTLAFRYQHGI 73

  Fly    86 LLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVA 150
            ::.|||||:.|..|.||::||::|||.::|||||||||||.:|:.||..|||||:|||||.|||:
pombe    74 VVCVDSRASAGPLIASQTVKKVIEINPYLLGTLAGGAADCQFWETVLGMECRLHQLRNKELISVS 138

  Fly   151 AASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSG 215
            |||||::||.:.|||.|||||.||||..|.|..|||:||:|:|..|:||||||||.:||||||||
pombe   139 AASKILSNITYSYKGYGLSMGTMLAGTGKGGTALYYIDSDGTRLKGDLFSVGSGSTFAYGVLDSG 203

  Fly   216 YHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTD 264
            |.|||..:||..|.:|:|..||.|||||||.:.:|||.|:|||...|.|
pombe   204 YRWDLSKQEALYLAQRSIVAATHRDAYSGGSVNLYHIDENGWVFHGNFD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 130/231 (56%)
proteasome_beta_type_5 74..261 CDD:239730 117/186 (63%)
pts1NP_593825.1 PRE1 39..262 CDD:223711 128/220 (58%)
proteasome_beta_type_5 62..249 CDD:239730 117/186 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 245 1.000 Domainoid score I422
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 258 1.000 Inparanoid score I755
OMA 1 1.010 - - QHG53702
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - otm47067
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1013
SonicParanoid 1 1.000 - - X647
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.