DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and CG30382

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:181 Identity:39/181 - (21%)
Similarity:64/181 - (35%) Gaps:52/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GGSYIGSQSMKKIVEINQFMLGTLAGGAADCV-------YWDRVLSKECRLHELRNKERISVAAA 152
            |..|....:.|.|.:.|   :.|:|..:.||.       ..::.:..|...|..|..:.|..|..
  Fly    20 GRLYQVEYAFKAIAQEN---ITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRITKDIGCAMT 81

  Fly   153 SKI-------------MANIAHEY--------------------------KGMGLSMGMMLAGYD 178
            .:|             .||..::|                          :.:|.|  |:|..||
  Fly    82 GRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCS--MVLIAYD 144

  Fly   179 KR-GPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQEL 228
            .. ||.:|..|..|..:.....|||:.:|.|...|:..|..:|.:::|.:|
  Fly   145 NEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 39/181 (22%)
proteasome_beta_type_5 74..261 CDD:239730 39/181 (22%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 39/181 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 39/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.